PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_66D0047A7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HSF
Protein Properties Length: 174aa    MW: 19644.5 Da    PI: 8.9114
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_66D0047A7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind45.12.6e-14124174252
                            HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHH CS
           HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaS 52 
                            Fl+k+++++ d++++ ++sw + gnsfvv+d++ fa  +Lp++Fkh nf+S
  Traes_4DL_66D0047A7.1 124 FLTKTFDLVADPATDGVVSWGRAGNSFVVWDPHLFAAVLLPRFFKHINFSS 174
                            9************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-16117174IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.36E-14120174IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.9E-6120174IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-9124147IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004477.7E-12124174IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-9162174IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
TRRAAQNLPS QPPSRRARSR TRQEYLSAST AHFPAEGKQP AKDHLRCVPL CYPILWFFGF  60
FRLRQEIAGC LLARPRGGMD RVLLPVRVKE EWPPPPPEEE EELEHGGLAP RPMEGLHETG  120
PPPFLTKTFD LVADPATDGV VSWGRAGNSF VVWDPHLFAA VLLPRFFKHI NFSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0611930.0KF061193.1 Triticum aestivum heat shock factor HsfA2d (HSFA2d) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649439.21e-39PREDICTED: heat stress transcription factor A-2d
SwissprotQ8H7Y63e-45HFA2D_ORYSJ; Heat stress transcription factor A-2d
TrEMBLW5EIA01e-125W5EIA0_WHEAT; Uncharacterized protein
STRINGORGLA03G0044000.12e-43(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.13e-31heat shock transcription factor A2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]